Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZFP36 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00007538-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ZFP36 protein.
  • Immunogen:
  • ZFP36 (NP_003398.1, 1 a.a. ~ 326 a.a) full-length human protein.
  • Sequence:
  • MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ZFP36 expression in transfected 293T cell line (H00007538-T02) by ZFP36 MaxPab polyclonal antibody.

    Lane 1: ZFP36 transfected lysate(34.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7538
  • Gene Name:
  • ZFP36
  • Gene Alias:
  • G0S24,GOS24,NUP475,RNF162A,TIS11,TTP
  • Gene Description:
  • zinc finger protein 36, C3H type, homolog (mouse)
  • Other Designations:
  • tristetraprolin,zinc finger protein 36, C3H type, homolog,zinc finger protein, C3H type, 36 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook