Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

YWHAZ (Human) Recombinant Protein (Q01)

  • Catalog # : H00007534-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human YWHAZ partial ORF ( NP_003397.1, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007534-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7534
  • Gene Name:
  • YWHAZ
  • Gene Alias:
  • KCIP-1,MGC111427,MGC126532,MGC138156
  • Gene Description:
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  • Gene Summary:
  • This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • 14-3-3 protein/cytosolic phospholipase A2,14-3-3 zeta,OTTHUMP00000165851,OTTHUMP00000165852,OTTHUMP00000165854,OTTHUMP00000165858,OTTHUMP00000165859,OTTHUMP00000165860,phospholipase A2,protein kinase C inhibitor protein-1,tyrosine 3/tryptophan 5 -monooxyg
  • RSS
  • YouTube
  • Linkedin
  • Facebook