YWHAZ (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human YWHAZ full-length ORF ( NP_003397.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
54.1
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — YWHAZ
Entrez GeneID
7534GeneBank Accession#
NM_003406.2Protein Accession#
NP_003397.1Gene Name
YWHAZ
Gene Alias
KCIP-1, MGC111427, MGC126532, MGC138156
Gene Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
Omim ID
601288Gene Ontology
HyperlinkGene Summary
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq
Other Designations
14-3-3 protein/cytosolic phospholipase A2|14-3-3 zeta|OTTHUMP00000165851|OTTHUMP00000165852|OTTHUMP00000165854|OTTHUMP00000165858|OTTHUMP00000165859|OTTHUMP00000165860|phospholipase A2|protein kinase C inhibitor protein-1|tyrosine 3/tryptophan 5 -monooxyg
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com