Product Browser

Last updated: 2014/4/21

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

YWHAZ monoclonal antibody (M12), clone 5E8

  • Catalog # : H00007534-M12
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant YWHAZ.
  • Immunogen:
  • YWHAZ (NP_003397.1, 1 a.a. ~ 245 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007534-M12
    Western Blot detection against Immunogen (54.1 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody (M12), clone 5E8.

    Lane 1: YWHAZ transfected lysate (Predicted MW: 27.7 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7534
  • Gene Name:
  • YWHAZ
  • Gene Alias:
  • KCIP-1,MGC111427,MGC126532,MGC138156
  • Gene Description:
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  • Gene Summary:
  • This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • 14-3-3 protein/cytosolic phospholipase A2,14-3-3 zeta,OTTHUMP00000165851,OTTHUMP00000165852,OTTHUMP00000165854,OTTHUMP00000165858,OTTHUMP00000165859,OTTHUMP00000165860,phospholipase A2,protein kinase C inhibitor protein-1,tyrosine 3/tryptophan 5 -monooxyg
  • RSS
  • YouTube
  • Linkedin
  • Facebook