YWHAZ monoclonal antibody (M04), clone 1B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant YWHAZ.
Immunogen
YWHAZ (NP_003397.1, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQ
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
YWHAZ monoclonal antibody (M04), clone 1B3. Western Blot analysis of YWHAZ expression in human kidney.Western Blot (Cell lysate)
YWHAZ monoclonal antibody (M04), clone 1B3. Western Blot analysis of YWHAZ expression in HL-60.Western Blot (Transfected lysate)
Western Blot analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody (M04), clone 1B3.
Lane 1: YWHAZ transfected lysate(27.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged YWHAZ is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — YWHAZ
Entrez GeneID
7534GeneBank Accession#
NM_003406.2Protein Accession#
NP_003397.1Gene Name
YWHAZ
Gene Alias
KCIP-1, MGC111427, MGC126532, MGC138156
Gene Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
Omim ID
601288Gene Ontology
HyperlinkGene Summary
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq
Other Designations
14-3-3 protein/cytosolic phospholipase A2|14-3-3 zeta|OTTHUMP00000165851|OTTHUMP00000165852|OTTHUMP00000165854|OTTHUMP00000165858|OTTHUMP00000165859|OTTHUMP00000165860|phospholipase A2|protein kinase C inhibitor protein-1|tyrosine 3/tryptophan 5 -monooxyg
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com