Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

YWHAG (Human) Recombinant Protein (Q02)

  • Catalog # : H00007532-Q02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human YWHAG partial ORF ( NP_036611, 70 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007532-Q02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7532
  • Gene Name:
  • YWHAG
  • Gene Alias:
  • 14-3-3GAMMA
  • Gene Description:
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
  • Gene Summary:
  • This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. [provided by RefSeq
  • Other Designations:
  • 14-3-3 gamma
  • RSS
  • YouTube
  • Linkedin
  • Facebook