Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

YWHAG polyclonal antibody (A02)

  • Catalog # : H00007532-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant YWHAG.
  • Immunogen:
  • YWHAG (NP_036611, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007532-A02
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7532
  • Gene Name:
  • YWHAG
  • Gene Alias:
  • 14-3-3GAMMA
  • Gene Description:
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
  • Gene Summary:
  • This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. [provided by RefSeq
  • Other Designations:
  • 14-3-3 gamma
  • RSS
  • YouTube
  • Linkedin
  • Facebook