Product Browser

Last updated: 2017/3/19
  • Related Product Showcase
  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

YWHAE polyclonal antibody (A01)

  • Catalog # : H00007531-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant YWHAE.
  • Immunogen:
  • YWHAE (AAH00179, 1 a.a. ~ 255 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007531-A01
    Western Blot detection against Immunogen (54.16 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7531
  • Gene Name:
  • YWHAE
  • Gene Alias:
  • 14-3-3E,FLJ45465,KCIP-1,MDCR,MDS
  • Gene Description:
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
  • Gene Summary:
  • This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 14-3-3 epsilon,mitochondrial import stimulation factor L subunit,protein kinase C inhibitor protein-1,tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide
  • RSS
  • YouTube
  • Linkedin
  • Facebook