Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

YWHAB (Human) Recombinant Protein (P01)

  • Catalog # : H00007529-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human YWHAB full-length ORF ( AAH01359, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEERQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 52.80
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007529-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7529
  • Gene Name:
  • YWHAB
  • Gene Alias:
  • GW128,HS1,KCIP-1
  • Gene Description:
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide
  • Gene Summary:
  • This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • 14-3-3 protein beta/alpha,OTTHUMP00000031075,OTTHUMP00000031076,brain protein 14-3-3, beta isoform,protein 1054,protein kinase C inhibitor protein-1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook