Product Browser

Last updated: 2017/3/26
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

YES1 polyclonal antibody (A01)

  • Catalog # : H00007525-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant YES1.
  • Immunogen:
  • YES1 (AAH48960, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007525-A01
    Western Blot detection against Immunogen (34.8 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7525
  • Gene Name:
  • YES1
  • Gene Alias:
  • HsT441,P61-YES,Yes,c-yes
  • Gene Description:
  • v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
  • Gene Summary:
  • This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000162194,Yamaguchi sarcoma oncogene,cellular yes-1 protein,proto-oncogene tyrosine-protein kinase YES,viral oncogene yes-1 homolog 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook