Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

XRCC3 monoclonal antibody (M02), clone 1H7

  • Catalog # : H00007517-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant XRCC3.
  • Immunogen:
  • XRCC3 (AAH11725, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged XRCC3 is 3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7517
  • Gene Name:
  • XRCC3
  • Gene Alias:
  • -
  • Gene Description:
  • X-ray repair complementing defective repair in Chinese hamster cells 3
  • Gene Summary:
  • This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene functionally complements Chinese hamster irs1SF, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents and is chromosomally unstable. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
  • Other Designations:
  • DNA repair protein XRCC3,RAD51-like,X-ray repair cross complementing protein 3,X-ray-repair, complementing defective, repair in Chinese hamster
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook