XG MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of XG expression in transfected 293T cell line (H00007499-T01) by XG MaxPab polyclonal antibody.
Lane 1: XG transfected lysate(19.91 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human XG protein.
Immunogen
XG (AAI00768.1, 1 a.a. ~ 181 a.a) full-length human protein.
Sequence
MESWWGLPCLAFLCFLMHARGQRDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPENPDSGGNIYPRPKPRPQPQPGNSGNSGGSYFNDVDRDDGRYPPRPRPRPPAGGGGGGYSSYGNSDNTHGGDHHSTYGNPEGNMVAKIVSPIVSVVVVTLLGAAASYFKLNNRRNCFRTHEPENV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of XG expression in transfected 293T cell line (H00007499-T01) by XG MaxPab polyclonal antibody.
Lane 1: XG transfected lysate(19.91 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — XG
Entrez GeneID
7499GeneBank Accession#
BC100767.1Protein Accession#
AAI00768.1Gene Name
XG
Gene Alias
MGC118758, MGC118759, MGC118760, MGC118761, PBDX
Gene Description
Xg blood group
Omim ID
314700Gene Ontology
HyperlinkGene Summary
This gene encodes the XG blood group antigen, and is located at the pseudoautosomal boundary on the short (p) arm of chromosome X. The three 5' exons reside in the pseudoautosomal region and the remaining exons within the X-specific end. A truncated copy of this gene is found on the Y chromosome at the pseudoautosomal boundary. It is transcribed, but not expected to make a Y-chromosome specific gene product. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022846|XG glycoprotein|Xg blood group (pseudoautosomal boundary-divided on the X chromosome)
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com