WNT8A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of WNT8A expression in transfected 293T cell line (H00007478-T01) by WNT8A MaxPab polyclonal antibody.
Lane 1: WNT8A transfected lysate(38.61 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human WNT8A protein.
Immunogen
WNT8A (NP_490645, 1 a.a. ~ 351 a.a) full-length human protein.
Sequence
MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQCRHVVSKYYCARSPGSAQSLGKGSA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (82)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of WNT8A expression in transfected 293T cell line (H00007478-T01) by WNT8A MaxPab polyclonal antibody.
Lane 1: WNT8A transfected lysate(38.61 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — WNT8A
Entrez GeneID
7478GeneBank Accession#
NM_058244Protein Accession#
NP_490645Gene Name
WNT8A
Gene Alias
WNT8D
Gene Description
wingless-type MMTV integration site family, member 8A
Omim ID
606360Gene Ontology
HyperlinkGene Summary
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and may be implicated in development of early embryos as well as germ cell tumors. It encodes a protein which shows 81% amino acid identity to the mouse Wnt8A protein. [provided by RefSeq
Other Designations
OTTHUMP00000180556|WNT8d
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Tannic Acid Promotes TRAIL-Induced Extrinsic Apoptosis by Regulating Mitochondrial ROS in Human Embryonic Carcinoma Cells.
Sp N, Kang DY, Jo ES, Rugamba A, Kim WS, Park YM, Hwang DY, Yoo JS, Liu Q, Jang KJ, Yang YM.
Cells 2020 Jan; 9(2):E282.
Application：WB-Ce, Human, NCCIT cells.
-
Tannic Acid Promotes TRAIL-Induced Extrinsic Apoptosis by Regulating Mitochondrial ROS in Human Embryonic Carcinoma Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com