WNT7B (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human WNT7B partial ORF ( NP_478679, 241 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.73
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — WNT7B
Entrez GeneID
7477GeneBank Accession#
NM_058238Protein Accession#
NP_478679Gene Name
WNT7B
Gene Alias
-
Gene Description
wingless-type MMTV integration site family, member 7B
Omim ID
601967Gene Ontology
HyperlinkGene Summary
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Identification of antibody against wingless-type MMTV integration site family member 7B as a biliary cancer tumor marker.
Mizuna Takahashi, Takahiro Tsuchikawa, Takaki Hiwasa, Toru Nakamura, Koji Hontani, Toshihiro Kushibiki, Kazuho Inoko, Hironobu Takano, Yutaka Hatanaka, Kazuyuki Matsushita, Hisahiro Matsubara, Tyuji Hoshino, Masayuki Ohtsuka, Hideaki Shimada, Kimitaka Tanaka, Yoshitsugu Nakanishi, Toshimichi Asano, Takehiro Noji, Keisuke Okamura, Toshiaki Shichinohe, Satoshi Hirano.
Oncology Reports 2023 Feb; 49(2):34.
Application：Antigen, Recombinant proteins.
-
Wnt1 inhibits vascular smooth muscle cell calcification by promoting ANKH expression.
Chen B, Zhao Y, Han D, Zhao B, Mao Y, Cui ZK, Chu YC, Feng L, Yin S, Wang CY, Wang X, Xu MJ, Zhao G.
Journal of Molecular and Cellular Cardiology 2019 Jul; 135:10.
Application：Func, Human, Human vascular smooth muscle cells.
-
Identification of antibody against wingless-type MMTV integration site family member 7B as a biliary cancer tumor marker.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com