WNT7B purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human WNT7B protein.
Immunogen
WNT7B (NP_478679.1, 1 a.a. ~ 349 a.a) full-length human protein.
Sequence
MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of WNT7B expression in transfected 293T cell line (H00007477-T02) by WNT7B MaxPab polyclonal antibody.
Lane 1: WNT7B transfected lysate(38.39 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — WNT7B
Entrez GeneID
7477GeneBank Accession#
NM_058238Protein Accession#
NP_478679.1Gene Name
WNT7B
Gene Alias
-
Gene Description
wingless-type MMTV integration site family, member 7B
Omim ID
601967Gene Ontology
HyperlinkGene Summary
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Neonatal Wnt-dependent Lgr5 positive stem cells are essential for uterine gland development.
Seishima R, Leung C, Yada S, Murad KBA, Tan LT, Hajamohideen A, Tan SH, Itoh H, Murakami K, Ishida Y, Nakamizo S, Yoshikawa Y, Wong E, Barker N.
Nature Communications 2019 Nov; 10(1):5378.
Application:Func, Mouse, Mouse endometrial cells.
-
Neonatal Wnt-dependent Lgr5 positive stem cells are essential for uterine gland development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com