Product Browser

Last updated: 2017/8/13
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

WNT7B polyclonal antibody (A01)

  • Catalog # : H00007477-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant WNT7B.
  • Immunogen:
  • WNT7B (NP_478679, 241 a.a. ~ 349 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007477-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7477
  • Gene Name:
  • WNT7B
  • Gene Alias:
  • -
  • Gene Description:
  • wingless-type MMTV integration site family, member 7B
  • Gene Summary:
  • This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. [provided by RefSeq
  • Other Designations:
  • -
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook