WNT5A monoclonal antibody (M04), clone 3A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WNT5A.
Immunogen
WNT5A (AAH64694, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to WNT5A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WNT5A is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — WNT5A
Entrez GeneID
7474GeneBank Accession#
BC064694Protein Accession#
AAH64694Gene Name
WNT5A
Gene Alias
hWNT5A
Gene Description
wingless-type MMTV integration site family, member 5A
Omim ID
164975Gene Ontology
HyperlinkGene Summary
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. [provided by RefSeq
Other Designations
WNT-5A protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
WNT5A inhibition alters the malignant peripheral nerve sheath tumor microenvironment and enhances tumor growth.
Craig S Thomson, Jay Pundavela, Melissa R Perrino, Robert A Coover, Kwangmin Choi, Katherine E Chaney, Tilat A Rizvi, David A Largaespada, Nancy Ratner.
Oncogene 2021 Jun; 40(24):4229.
Application:IHC-P, Human, Mouse, Human malignant peripheral nerve sheath tumors, Human normal nerve, Human plexiform neurofibromas, S462-TY Mouse xenograft.
-
Higher expression of WNT5A protein in oral squamous cell carcinoma compared with dysplasia and oral mucosa with a normal appearance.
Prgomet Z, Andersson T, Lindberg P.
European journal of Oral Sciences 2017 Jun; 125(4):237.
Application:IHC-P, Human, Human dysplasia and oral mucosa, Human oral squamous cell carcinoma.
-
WNT5A has Anti-Prostate Cancer Effects In Vitro and Reduces Tumor Growth in the Skeleton In Vivo.
Thiele S, Gobel A, Rachner TD, Fuessel S, Froehner M, Muders MH, Baretton GB, Bernhardt R, Jakob F, Gluer CC, Bornhauser M, Rauner M, Hofbauer LC.
Journal of Bone and Mineral Research 2015 Mar; 30(3):471.
Application:IHC-P, Human, Prostate Cancer.
-
WNT5A inhibition alters the malignant peripheral nerve sheath tumor microenvironment and enhances tumor growth.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com