WHSC2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant WHSC2.
Immunogen
WHSC2 (NP_005654, 429 a.a. ~ 527 a.a) partial recombinant protein with GST tag.
Sequence
KNLSLTREQMFAAQEMFKTANKVTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDLPKADGQGSTTMLVDTVFEMNYATGQWTRFKKYKPMTNV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — WHSC2
Entrez GeneID
7469GeneBank Accession#
NM_005663Protein Accession#
NP_005654Gene Name
WHSC2
Gene Alias
FLJ10442, FLJ25112, NELF-A, NELFA, P/OKcl.15
Gene Description
Wolf-Hirschhorn syndrome candidate 2
Omim ID
606026Gene Ontology
HyperlinkGene Summary
This gene is expressed ubiquitously with higher levels in fetal than in adult tissues. It encodes a protein sharing 93% sequence identity with the mouse protein. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene is mapped to the 165 kb WHS critical region, and may play a role in the phenotype of the WHS or Pitt-Rogers-Danks syndrome. The encoded protein is found to be capable of reacting with HLA-A2-restricted and tumor-specific cytotoxic T lymphocytes, suggesting a target for use in specific immunotherapy for a large number of cancer patients. This protein has also been shown to be a member of the NELF (negative elongation factor) protein complex that participates in the regulation of RNA polymerase II transcription elongation. [provided by RefSeq
Other Designations
Wolf-Hirschhorn syndrome candidate 2 protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com