Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLIP2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007461-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CLIP2 partial ORF ( NP_003379, 946 a.a. - 1046 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.85
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007461-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7461
  • Gene Name:
  • CLIP2
  • Gene Alias:
  • CLIP,CLIP-115,CYLN2,KIAA0291,MGC11333,WBSCR3,WBSCR4,WSCR3,WSCR4
  • Gene Description:
  • CAP-GLY domain containing linker protein 2
  • Gene Summary:
  • The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules and an organelle called the dendritic lamellar body. This gene is hemizygously deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000160724,Williams-Beuren syndrome chromosome region 3,Williams-Beuren syndrome chromosome region 4,cytoplasmic linker 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook