Product Browser

Last updated: 2017/10/15
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLIP2 polyclonal antibody (A01)

  • Catalog # : H00007461-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CLIP2.
  • Immunogen:
  • CLIP2 (NP_003379, 946 a.a. ~ 1046 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007461-A01
    Western Blot detection against Immunogen (37.22 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7461
  • Gene Name:
  • CLIP2
  • Gene Alias:
  • CLIP,CLIP-115,CYLN2,KIAA0291,MGC11333,WBSCR3,WBSCR4,WSCR3,WSCR4
  • Gene Description:
  • CAP-GLY domain containing linker protein 2
  • Gene Summary:
  • The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules and an organelle called the dendritic lamellar body. This gene is hemizygously deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000160724,Williams-Beuren syndrome chromosome region 3,Williams-Beuren syndrome chromosome region 4,cytoplasmic linker 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook