VRK2 monoclonal antibody (M01J), clone 3B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant VRK2.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
VRK2 (AAH27854, 260 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (100)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
VRK2 monoclonal antibody (M01J), clone 3B10. Western Blot analysis of VRK2 expression in U-2 OS.Western Blot (Cell lysate)
VRK2 monoclonal antibody (M01J), clone 3B10. Western Blot analysis of VRK2 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of VRK2 expression in transfected 293T cell line by VRK2 monoclonal antibody (M01J), clone 3B10.
Lane 1: VRK2 transfected lysate (Predicted MW: 58.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VRK2 is 0.3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of VRK2 over-expressed 293 cell line, cotransfected with VRK2 Validated Chimera RNAi ( Cat # H00007444-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with VRK2 monoclonal antibody (M01) clone 3B10 (Cat # H00007444-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to VRK2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — VRK2
Entrez GeneID
7444GeneBank Accession#
BC027854Protein Accession#
AAH27854Gene Name
VRK2
Gene Alias
-
Gene Description
vaccinia related kinase 2
Omim ID
602169Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, leukocytes, fetal liver, and carcinomas. Its protein localizes to the endoplasmic reticulum and has been shown to phosphorylate casein and undergo autophosphorylation. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
vaccinia virus B1R-related kinase 2|vaccinia-related kinase-2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com