TRPV1 monoclonal antibody (M02), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRPV1.
Immunogen
TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TRPV1 monoclonal antibody (M02), clone 1A8. Western Blot analysis of TRPV1 expression in rat thymus.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRPV1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — TRPV1
Entrez GeneID
7442GeneBank Accession#
NM_080706Protein Accession#
NP_542437Gene Name
TRPV1
Gene Alias
DKFZp434K0220, VR1
Gene Description
transient receptor potential cation channel, subfamily V, member 1
Omim ID
602076Gene Ontology
HyperlinkGene Summary
Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a non-selective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Four transcript variants encoding the same protein, but with different 5' UTR sequence, have been described for this gene. [provided by RefSeq
Other Designations
capsaicin receptor|transient receptor potential vanilloid 1a|transient receptor potential vanilloid 1b|vanilloid receptor subtype 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The molecular pathway of ATP-sensitive potassium channel in endothelial cells for mediating arteriole relaxation.
Chen X, Han W, Zhang Y, Cui W, Pan Z, Jin X, Long C, Wang H.
Life Sciences 2015 Sep; 137:164.
Application:WB-Ce, Human, EA.hy926 cells.
-
Nerve growth factor rescues diabetic mice heart after ischemia/reperfusion injury via up-regulation of the TRPV1 receptor.
Zheng LR, Zhang YY, Han J, Sun ZW, Zhou SX, Zhao WT, Wang LH.
Journal of Diabetes and Its Complications 2015 Apr; 29(3):323.
Application:WB, Mouse, Heart.
-
The molecular pathway of ATP-sensitive potassium channel in endothelial cells for mediating arteriole relaxation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com