TRPV1 monoclonal antibody (M01), clone 1F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRPV1.
Immunogen
TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRPV1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — TRPV1
Entrez GeneID
7442GeneBank Accession#
NM_080706Protein Accession#
NP_542437Gene Name
TRPV1
Gene Alias
DKFZp434K0220, VR1
Gene Description
transient receptor potential cation channel, subfamily V, member 1
Omim ID
602076Gene Ontology
HyperlinkGene Summary
Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a non-selective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Four transcript variants encoding the same protein, but with different 5' UTR sequence, have been described for this gene. [provided by RefSeq
Other Designations
capsaicin receptor|transient receptor potential vanilloid 1a|transient receptor potential vanilloid 1b|vanilloid receptor subtype 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Endogenous Mas-related G-protein-coupled receptor X1 activates and sensitizes TRPA1 in a human model of peripheral nerves.
Hayley McMillan, Fionnuala T Lundy, Orla M Dunne, Banan Al-Natour, Charlotte Jeanneau, Imad About, Tim M Curtis, Ikhlas El Karim.
FASEB Journal 2021 May; 35(5):e21492.
Application:IF, IHC, Human, Human dental pulp, Human peripheral neuronal equivalent cells.
-
Upregulation of Vanilloid Receptor-1 in Functional Dyspepsia With or Without Helicobacter pylori Infection.
Choi YJ, Kim N, Kim J, Lee DH, Park JH, Jung HC.
Medicine 2016 May; 95(19):e3410.
Application:WB, Human, AGS cell.
-
Human odontoblasts express functional thermo-sensitive TRP channels: Implications for dentin sensitivity.
El Karim IA, Linden GJ, Curtis TM, About I, McGahon MK, Irwin CR, Lundy FT.
Pain 2011 Oct; 152(10):2211.
Application:IHC, WB, Human, Odontoblast cells.
-
Endogenous expression of TRPV1 channel in cultured human melanocytes.
Choi TY, Park SY, Jo JY, Kang G, Park JB, Kim JG, Hong SG, Kim CD, Lee JH, Yoon TJ.
Journal of Dermatological Science 2009 Nov; 56(2):128.
Application:WB-Ce, Human, Fibroblasts, HaCaT, Keratinocytes, Melanocytes.
-
Endogenous Mas-related G-protein-coupled receptor X1 activates and sensitizes TRPA1 in a human model of peripheral nerves.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com