VIPR2 monoclonal antibody (M01), clone 2E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant VIPR2.
Immunogen
VIPR2 (NP_003373, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
VIPR2 monoclonal antibody (M01), clone 2E3. Western Blot analysis of VIPR2 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — VIPR2
Entrez GeneID
7434GeneBank Accession#
NM_003382Protein Accession#
NP_003373Gene Name
VIPR2
Gene Alias
FLJ16511, VPAC2, VPCAP2R
Gene Description
vasoactive intestinal peptide receptor 2
Omim ID
601970Gene Ontology
HyperlinkGene Summary
Vasoactive intestinal peptide (VIP; MIM 192320) and pituitary adenylate cyclase activating polypeptide (PACAP; MIM 102980) are homologous peptides that function as neurotransmitters and neuroendocrine hormones. While the receptors for VIP and PACAP share homology, they differ in their substrate specificities and expression patterns. See VIPR1 (MIM 192321) and ADCYAP1R1(MIM 102981).[supplied by OMIM
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Human CD4 + CD45RA + T Cells Behavior after In Vitro Activation: Modulatory Role of Vasoactive Intestinal Peptide.
Raúl Villanueva-Romero, Alicia Cabrera-Martín, Emigdio Álvarez-Corrales, Mar Carrión, Selene Pérez-García, Amalia Lamana, David Castro-Vázquez, Carmen Martínez, Rosa P Gomariz, Irene Gutiérrez-Cañas, Yasmina Juarranz.
International Journal of Molecular Sciences 2022 Feb; 23(4):2346.
Application:WB-Ce, Human, CD4+CD45RA+ T cells.
-
Vasoactive intestinal peptide axis is dysfunctional in patients with Graves' disease.
M Carrión, A M Ramos-Leví, I V Seoane, R Martínez-Hernández, A Serrano-Somavilla, D Castro, Y Juarranz, I González-Álvaro, Rosa P Gomariz, Mónica Marazuela.
Scientific Reports 2020 Aug; 10(1):13018.
Application:WB, Human, PBMC.
-
Activation of Th lymphocytes alters pattern expression and cellular location of VIP receptors in healthy donors and early arthritis patients.
Villanueva-Romero R, Gutiérrez-Cañas I, Carrión M, González-Álvaro I, Rodríguez-Frade JM, Mellado M, Martínez C, Gomariz RP, Juarranz Y.
Scientific Reports 2019 May; 9(1):7383.
Application:IF, WB-Ce, Human, Th cells.
-
VIP impairs acquisition of the macrophage proinflammatory polarization profile.
Carrión M, Pérez-García S, Martínez C, Juarranz Y, Estrada-Capetillo L, Puig-Kröger A, Gomariz RP, Gutiérrez-Cañas I.
Journal of Leukocyte Biology 2016 Dec; 100(6):1385.
Application:IF, WB, Human, Human PBMCs (Macrophages).
-
Human CD4 + CD45RA + T Cells Behavior after In Vitro Activation: Modulatory Role of Vasoactive Intestinal Peptide.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com