Product Browser

Last updated: 2020/8/2

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VIM (Human) Recombinant Protein HuPro Protein

  • Catalog # : H00007431-H03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified VIM (NP_003371.2 , 408 a.a. - 466 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • ESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 31.24
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-VIM plasmid into HEK293T cell, and the expressed protein was purified by protein A.
  • Purification:
  • Protein A purification
  • Concentration:
  • >= 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00007431-H03

    Western Blot
    QC Testing of H00007431-H03
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 7431
  • Gene Name:
  • VIM
  • Gene Alias:
  • FLJ36605
  • Gene Description:
  • vimentin
  • Gene Summary:
  • This gene encodes a member of the intermediate filament family. Intermediate filamentents, along with microtubules and actin microfilaments, make up the cytoskeleton. The protein encoded by this gene is responsible for maintaining cell shape, integrity of the cytoplasm, and stabilizing cytoskeletal interactions. It is also involved in the immune response, and controls the transport of low-density lipoprotein (LDL)-derived cholesterol from a lysosome to the site of esterification. It functions as an organizer of a number of critical proteins involved in attachment, migration, and cell signaling. Mutations in this gene causes a dominant, pulverulent cataract
  • Other Designations:
  • OTTHUMP00000019224
  • RSS
  • YouTube
  • Linkedin
  • Facebook