VHL (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human VHL full-length ORF ( ENSP00000344757, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
46.1
Interspecies Antigen Sequence
Mouse (63); Rat (63)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — VHL
Entrez GeneID
7428GeneBank Accession#
ENST00000345392Protein Accession#
ENSP00000344757Gene Name
VHL
Gene Alias
HRCA1, RCA1, VHL1
Gene Description
von Hippel-Lindau tumor suppressor
Gene Ontology
HyperlinkGene Summary
Von Hippel-Lindau syndrome (VHL) is a dominantly inherited familial cancer syndrome predisposing to a variety of malignant and benign tumors. A germline mutation of this gene is the basis of familial inheritance of VHL syndrome. The protein encoded by this gene is a component of the protein complex that includes elongin B, elongin C, and cullin-2, and possesses ubiquitin ligase E3 activity. This protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. RNA polymerase II subunit POLR2G/RPB7 is also reported to be a target of this protein. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
elongin binding protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
WSB1 promotes tumor metastasis by inducing pVHL degradation.
Kim JJ, Lee SB, Jang J, Yi SY, Kim SH, Han SA, Lee JM, Tong SY, Vincelette ND, Gao B, Yin P, Evans D, Choi DW, Qin B, Liu T, Zhang H, Deng M, Jen J, Zhang J, Wang L, Lou Z.
Genes & Development 2015 Nov; 29(21):2244.
Application:IP, WB, Human, HEK293T cells.
-
WSB1 promotes tumor metastasis by inducing pVHL degradation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com