VHL monoclonal antibody (M01), clone 1G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of VHL expression in transfected 293T cell line by VHL monoclonal antibody (M01), clone 1G12.
Lane 1: VHL transfected lysate(19.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VHL is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to VHL on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (38.21 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant VHL.
Immunogen
VHL (NP_000542, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (84)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of VHL expression in transfected 293T cell line by VHL monoclonal antibody (M01), clone 1G12.
Lane 1: VHL transfected lysate(19.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VHL is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to VHL on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — VHL
Entrez GeneID
7428GeneBank Accession#
NM_000551Protein Accession#
NP_000542Gene Name
VHL
Gene Alias
HRCA1, RCA1, VHL1
Gene Description
von Hippel-Lindau tumor suppressor
Gene Ontology
HyperlinkGene Summary
Von Hippel-Lindau syndrome (VHL) is a dominantly inherited familial cancer syndrome predisposing to a variety of malignant and benign tumors. A germline mutation of this gene is the basis of familial inheritance of VHL syndrome. The protein encoded by this gene is a component of the protein complex that includes elongin B, elongin C, and cullin-2, and possesses ubiquitin ligase E3 activity. This protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. RNA polymerase II subunit POLR2G/RPB7 is also reported to be a target of this protein. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
elongin binding protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com