VAV1 monoclonal antibody (M02), clone 1A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
VAV1 monoclonal antibody (M02), clone 1A6 Western Blot analysis of VAV1 expression in HL-60 ( Cat # L014V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VAV1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant VAV1.
Immunogen
VAV1 (AAH13361, 681 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
VAV1 monoclonal antibody (M02), clone 1A6 Western Blot analysis of VAV1 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VAV1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — VAV1
Entrez GeneID
7409GeneBank Accession#
BC013361Protein Accession#
AAH13361Gene Name
VAV1
Gene Alias
VAV
Gene Description
vav 1 guanine nucleotide exchange factor
Omim ID
164875Gene Ontology
HyperlinkGene Summary
The protein encoded by this proto-oncogene is a member of the Dbl family of guanine nucleotide exchange factors (GEF) for the Rho family of GTP binding proteins. The protein is important in hematopoiesis, playing a role in T-cell and B-cell development and activation. This particular GEF has been identified as the specific binding partner of Nef proteins from HIV-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the JNK/SAPK signaling cascade, leading to increased levels of viral transcription and replication. [provided by RefSeq
Other Designations
oncogene vav|vav 1 oncogene|vav proto-oncogene
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com