UVRAG monoclonal antibody (M04), clone 2E8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of UVRAG expression in transfected 293T cell line by UVRAG monoclonal antibody (M04), clone 2E8.
Lane 1: UVRAG transfected lysate (Predicted MW: 78.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UVRAG is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to UVRAG on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UVRAG.
Immunogen
UVRAG (NP_003360.2, 601 a.a. ~ 699 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LPSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UVRAG expression in transfected 293T cell line by UVRAG monoclonal antibody (M04), clone 2E8.
Lane 1: UVRAG transfected lysate (Predicted MW: 78.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UVRAG is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to UVRAG on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — UVRAG
Entrez GeneID
7405GeneBank Accession#
NM_003369Protein Accession#
NP_003360.2Gene Name
UVRAG
Gene Alias
DHTX, p63
Gene Description
UV radiation resistance associated gene
Omim ID
602493Gene Ontology
HyperlinkGene Summary
This gene complements the ultraviolet sensitivity of xeroderma pigmentosum group C cells and encodes a protein with a C2 domain. The protein activates the Beclin1-PI(3)KC3 complex, promoting autophagy and suppressing the proliferation and tumorigenicity of human colon cancer cells. Chromosomal aberrations involving this gene are associated with left-right axis malformation and mutations in this gene have been associated with colon cancer. [provided by RefSeq
Other Designations
UV radiation resistance associated|disrupted in heterotaxy
-
Interactome
-
Disease
-
Publication Reference
-
Selective MAP1LC3C (LC3C) autophagy requires noncanonical regulators and the C-terminal peptide.
Megan E Bischoff, Yuanwei Zang, Johnson Chu, Adam D Price, Birgit Ehmer, Nicholas J Talbot, Michael J Newbold, Anurag Paul, Jun-Lin Guan, David R Plas, Jarek Meller, Maria F Czyzyk-Krzeska.
The Journal of Cell Biology 2021 Jul; 220(7):e202004182.
Application：WB, IF, Human, HEK293T, 786-O, A498, Caki-1, UOK 257 cells.
-
Selective MAP1LC3C (LC3C) autophagy requires noncanonical regulators and the C-terminal peptide.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com