UNG purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human UNG protein.
Immunogen
UNG (NP_003353.1, 1 a.a. ~ 304 a.a) full-length human protein.
Sequence
MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
UNG MaxPab polyclonal antibody. Western Blot analysis of UNG expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of UNG expression in transfected 293T cell line (H00007374-T01) by UNG MaxPab polyclonal antibody.
Lane 1: UNG transfected lysate(33.44 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to UNG on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — UNG
Entrez GeneID
7374GeneBank Accession#
NM_003362Protein Accession#
NP_003353.1Gene Name
UNG
Gene Alias
DGU, DKFZp781L1143, HIGM4, UDG, UNG1, UNG15, UNG2
Gene Description
uracil-DNA glycosylase
Gene Ontology
HyperlinkGene Summary
This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. [provided by RefSeq
Other Designations
uracil-DNA glycosylase 1, uracil-DNA glycosylase 2|uracil-DNA glycosylase 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The Cullin-RING E3 Ubiquitin Ligase CRL4-DCAF1 Complex Dimerizes via a Short Helical Region in DCAF1.
Ahn J, Novince Z, Concel J, Byeon CH, Makhov AM, Byeon IJ, Zhang P, Gronenborn AM.
Biochemistry 2011 Mar; 50(8):1359.
Application:WB, Recombinant protein.
-
The Cullin-RING E3 Ubiquitin Ligase CRL4-DCAF1 Complex Dimerizes via a Short Helical Region in DCAF1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com