Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UMPS polyclonal antibody (A01)

  • Catalog # : H00007372-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant UMPS.
  • Immunogen:
  • UMPS (NP_000364, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007372-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7372
  • Gene Name:
  • UMPS
  • Gene Alias:
  • OPRT
  • Gene Description:
  • uridine monophosphate synthetase
  • Other Designations:
  • OMPdecase,OPRtase,UMP synthase,orotate phosphoribosyl transferase and orotidine-5'-decarboxylase,orotate phosphoribosyltransferase phosphoribosyltransferase,orotidine 5'-phosphate decarboxylase,uridine monophosphate synthase
  • RSS
  • YouTube
  • Linkedin
  • Facebook