UMOD monoclonal antibody (M03), clone 3F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UMOD.
Immunogen
UMOD (NP_001008390.1, 25 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHC
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UMOD expression in transfected 293T cell line by UMOD monoclonal antibody (M03), clone 3F10.
Lane 1: UMOD transfected lysate (Predicted MW: 66.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of UMOD transfected lysate using anti-UMOD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UMOD MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UMOD is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — UMOD
Entrez GeneID
7369GeneBank Accession#
NM_001008389Protein Accession#
NP_001008390.1Gene Name
UMOD
Gene Alias
ADMCKD2, FJHN, HNFJ, MCKD2, THGP, THP
Gene Description
uromodulin
Gene Ontology
HyperlinkGene Summary
This gene encodes uromodulin, the most abundant protein in normal urine. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the loop of Henle. Uromodulin may act as a constitutive inhibitor of calcium crystallization in renal fluids. Excretion of uromodulin in urine may provide defense against urinary tract infections caused by uropathogenic bacteria. Defects in this gene are associated with the autosomal dominant renal disorders medullary cystic kidney disease-2 (MCKD2) and familial juvenile hyperuricemic nephropathy (FJHN). These disorders are characterized by juvenile onset of hyperuricemia, gout, and progressive renal failure. While several transcript variants may exist for this gene, the full-length natures of only two have been described to date. These two represent the major variants of this gene and encode the same isoform. [provided by RefSeq
Other Designations
OTTHUMP00000162212|Tamm-Horsfall glycoprotein|uromodulin (uromucoid, Tamm-Horsfall glycoprotein)|uromucoid
-
Interactome
-
Disease
-
Publication Reference
-
Exosome detection via the ultrafast-isolation system: EXODUS.
Yuchao Chen, Qingfu Zhu, Liming Cheng, Yong Wang, Meng Li, Qinsi Yang, Liang Hu, Doudou Lou, Jiaoyuan Li, Xianjun Dong, Luke P Lee, Fei Liu.
Nature Methods 2021 Feb; 18(2):212.
Application:WB, Human, Human urine.
-
A facile, rapid, high-throughput extracellular vesicles analytical platform for cancer detection.
Zaian Deng, Yong Wang, Liang Hu, Qingfu Zhu, Yuchao Chen, Jeff J Chen, Joyce Chen, Ting Zhang, Tae Seok Seo, Fei Liu.
Analytica Chimica Acta 2020 Nov; 1138:132.
Application:WB, Human, Extracellular vesicles from human urine samples.
-
Mass spectrometric study of stone matrix proteins of human bladder stones.
Jou YC, Tsai YS, Fang CY, Chen SY, Chen FH, Huang CH, Li YH, Shen CH.
Urology 2013 Aug; 82(2):295.
Application:WB, Human, Human bladder stones.
-
Proteomic study of renal uric acid stone.
Jou YC, Fang CY, Chen SY, Chen FH, Cheng MC, Shen CH, Liao LW, Tsai YS.
Urology 2012 Aug; 80(2):260.
Application:WB, Human, Pure kidney uric acid stones from 5 individuals.
-
Exosome detection via the ultrafast-isolation system: EXODUS.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com