UGCG monoclonal antibody (M03), clone 1E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
UGCG monoclonal antibody (M03), clone 1E5. Western Blot analysis of UGCG expression in HL-60.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UGCG is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UGCG.
Immunogen
UGCG (NP_003349, 33 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UGCG monoclonal antibody (M03), clone 1E5. Western Blot analysis of UGCG expression in HL-60.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UGCG is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — UGCG
Entrez GeneID
7357GeneBank Accession#
NM_003358Protein Accession#
NP_003349Gene Name
UGCG
Gene Alias
GCS
Gene Description
UDP-glucose ceramide glucosyltransferase
Omim ID
602874Gene Ontology
HyperlinkGene Summary
Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltransferase catalyzes the first glycosylation step in glycosphingolipid biosynthesis. The product, glucosylceramide, is the core structure of more than 300 GSLs. UGCG is widely expressed and transciption is upregulated during keratinocyte differentiation. [provided by RefSeq
Other Designations
OTTHUMP00000021925|ceramide glucosyltransferase|glucosylceramide synthase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Glucosylceramide synthase maintains influenza virus entry and infection.
Drews K, Calgi MP, Harrison WC, Drews CM, Costa-Pinheiro P, Shaw JJP, Jobe KA, Han JD, Fox TE, White JM, Kester M.
PLoS One 2020 Feb; 15(2):e0228735.
Application：WB-Tr, Human, A-549, HEK 293 cells.
-
A role for glycolipid biosynthesis in severe fever with thrombocytopenia syndrome virus entry.
Drake MJ, Brennan B, Briley K Jr, Bart SM, Sherman E, Szemiel AM, Minutillo M, Bushman FD, Bates P.
Amino Acids 2017 Apr; 13(4):e1006316.
Application：WB, Human, U-2 OS cells.
-
Fenretinide sensitizes multidrug-resistant human neuroblastoma cells to antibody-independent and ch14.18-mediated NK cell cytotoxicity.
Shibina A, Seidel D, Somanchi SS, Lee DA, Stermann A, Maurer BJ, Lode HN, Reynolds CP, Huebener N.
Journal of Molecular Medicine 2013 Apr; 91(4):459.
Application：WB-Ce, Human, CHLA-136 cells.
-
DNA damage induces down-regulation of UDP-glucose ceramide glucosyltransferase, increases ceramide levels and triggers apoptosis in p53-deficient cancer cells.
Haynes TA, Filippov V, Filippova M, Yang J, Zhang K, Duerksen-Hughes PJ.
Biochimica et Biophysica Acta 2012 Jul; 1821(7):943.
Application：WB-Tr, Human, U-2 OS cells.
-
Glucosylceramide synthase maintains influenza virus entry and infection.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com