Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC35A2 polyclonal antibody (A01)

  • Catalog # : H00007355-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLC35A2.
  • Immunogen:
  • SLC35A2 (NP_005651, 88 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007355-A01
    Western Blot detection against Immunogen (33.7 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7355
  • Gene Name:
  • SLC35A2
  • Gene Alias:
  • UGALT,UGAT,UGT,UGT1,UGT2,UGTL
  • Gene Description:
  • solute carrier family 35 (UDP-galactose transporter), member A2
  • Other Designations:
  • OTTHUMP00000025813,OTTHUMP00000025814,OTTHUMP00000025815,UDP-galactose translocator,solute carrier family 35 (UDP-galactose transporter), member 2,solute carrier family 35, member A2
  • RSS
  • YouTube
  • Linkedin
  • Facebook