Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UCHL1 polyclonal antibody (A02)

  • Catalog # : H00007345-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant UCHL1.
  • Immunogen:
  • UCHL1 (NP_004172, 101 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007345-A02
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • UCHL1 polyclonal antibody (A02), Lot # 060106JC01 Western Blot analysis of UCHL1 expression in PC-12 ( Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7345
  • Gene Name:
  • UCHL1
  • Gene Alias:
  • PARK5,PGP9.5,Uch-L1
  • Gene Description:
  • ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
  • Gene Summary:
  • The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease
  • Other Designations:
  • ubiquitin C-terminal esterase L1,ubiquitin carboxyl-terminal esterase L1,ubiquitin thiolesterase L1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook