UBTF (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human UBTF partial ORF ( NP_055048, 551 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — UBTF
Entrez GeneID
7343GeneBank Accession#
NM_014233Protein Accession#
NP_055048Gene Name
UBTF
Gene Alias
NOR-90, UBF
Gene Description
upstream binding transcription factor, RNA polymerase I
Omim ID
600673Gene Ontology
HyperlinkGene Summary
Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD, exist in the human (Bell et al., 1988 [PubMed 3413483]). UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]).[supplied by OMIM
Other Designations
-
-
Interactome
-
Publication Reference
-
Remodeling of ribosomal genes in somatic cells by Xenopus egg extract.
Ostrup O, Hyttel P, Klarke DA, Collas P.
Biochemical and Biophysical Research Communications 2011 Sep; 412(3):487.
-
Remodeling of ribosomal genes in somatic cells by Xenopus egg extract.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com