Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE2V2 (Human) Recombinant Protein (P01)

  • Catalog # : H00007336-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UBE2V2 full-length ORF ( NP_003341.1, 1 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007336-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7336
  • Gene Name:
  • UBE2V2
  • Gene Alias:
  • DDVIT1,DDVit-1,EDAF-1,EDPF-1,EDPF1,MMS2,UEV-2,UEV2
  • Gene Description:
  • ubiquitin-conjugating enzyme E2 variant 2
  • Gene Summary:
  • Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes. [provided by RefSeq
  • Other Designations:
  • 1 alpha,25-dihydroxyvitamin D3-inducible,enterocyte differentiation promoting factor,methyl methanesulfonate sensitive 2, S. cerevisiae, homolog of
  • RSS
  • YouTube
  • Linkedin
  • Facebook