Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE2V2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00007336-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human UBE2V2 protein.
  • Immunogen:
  • UBE2V2 (AAH07051, 1 a.a. ~ 145 a.a) full-length human protein.
  • Sequence:
  • MAVPTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRVYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of UBE2V2 expression in transfected 293T cell line (H00007336-T01) by UBE2V2 MaxPab polyclonal antibody.

    Lane 1: UBE2V2 transfected lysate(16.06 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7336
  • Gene Name:
  • UBE2V2
  • Gene Alias:
  • DDVIT1,DDVit-1,EDAF-1,EDPF-1,EDPF1,MMS2,UEV-2,UEV2
  • Gene Description:
  • ubiquitin-conjugating enzyme E2 variant 2
  • Gene Summary:
  • Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes. [provided by RefSeq
  • Other Designations:
  • 1 alpha,25-dihydroxyvitamin D3-inducible,enterocyte differentiation promoting factor,methyl methanesulfonate sensitive 2, S. cerevisiae, homolog of
  • RSS
  • YouTube
  • Linkedin
  • Facebook