UBE2G2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human UBE2G2 full-length ORF ( AAH08351.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43.78
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — UBE2G2
Entrez GeneID
7327GeneBank Accession#
BC008351.1Protein Accession#
AAH08351.1Gene Name
UBE2G2
Gene Alias
UBC7
Gene Description
ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast)
Omim ID
603124Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
ubiquitin carrier protein G2|ubiquitin conjugating enzyme 7|ubiquitin conjugating enzyme G2|ubiquitin-conjugating enzyme E2G 2|ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7)|ubiquitin-protein ligase G2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com