UBE2G2 monoclonal antibody (M01), clone 5E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
UBE2G2 monoclonal antibody (M01), clone 5E1 Western Blot analysis of UBE2G2 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of UBE2G2 expression in transfected 293T cell line by UBE2G2 monoclonal antibody (M01), clone 5E1.
Lane 1: UBE2G2 transfected lysate(15.6 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to UBE2G2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE2G2 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.31 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UBE2G2.
Immunogen
UBE2G2 (NP_003329, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.31 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBE2G2 monoclonal antibody (M01), clone 5E1 Western Blot analysis of UBE2G2 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of UBE2G2 expression in transfected 293T cell line by UBE2G2 monoclonal antibody (M01), clone 5E1.
Lane 1: UBE2G2 transfected lysate(15.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to UBE2G2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE2G2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — UBE2G2
Entrez GeneID
7327GeneBank Accession#
NM_003343Protein Accession#
NP_003329Gene Name
UBE2G2
Gene Alias
UBC7
Gene Description
ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast)
Omim ID
603124Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
ubiquitin carrier protein G2|ubiquitin conjugating enzyme 7|ubiquitin conjugating enzyme G2|ubiquitin-conjugating enzyme E2G 2|ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7)|ubiquitin-protein ligase G2
-
Interactome
-
Pathway
-
Publication Reference
-
Ataxin-3 Deubiquitination Is Coupled to Parkin Ubiquitination via E2 Ubiquitin-conjugating Enzyme.
Durcan TM, Kontogiannea M, Bedard N, Wing SS, Fon EA.
The Journal of Biological Chemistry 2012 Jan; 287(1):531.
Application：WB-Tr, Human, HEK 293 cells.
-
Ataxin-3 Deubiquitination Is Coupled to Parkin Ubiquitination via E2 Ubiquitin-conjugating Enzyme.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com