Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE2G2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00007327-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human UBE2G2 protein.
  • Immunogen:
  • UBE2G2 (NP_872630.1, 1 a.a. ~ 137 a.a) full-length human protein.
  • Sequence:
  • MNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • UBE2G2 MaxPab rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in mouse kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • UBE2G2 MaxPab rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in Jurkat.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7327
  • Gene Name:
  • UBE2G2
  • Gene Alias:
  • UBC7
  • Gene Description:
  • ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast)
  • Gene Summary:
  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • ubiquitin carrier protein G2,ubiquitin conjugating enzyme 7,ubiquitin conjugating enzyme G2,ubiquitin-conjugating enzyme E2G 2,ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7),ubiquitin-protein ligase G2
  • RSS
  • YouTube
  • Linkedin
  • Facebook