UBE2G2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
UBE2G2 MaxPab rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in mouse kidney.
Western Blot (Cell lysate)
UBE2G2 MaxPab rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in Jurkat.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to UBE2G2 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human UBE2G2 protein.
Immunogen
UBE2G2 (NP_872630.1, 1 a.a. ~ 137 a.a) full-length human protein.
Sequence
MNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
UBE2G2 MaxPab rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in mouse kidney.Western Blot (Cell lysate)
UBE2G2 MaxPab rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in Jurkat.Immunofluorescence
Immunofluorescence of purified MaxPab antibody to UBE2G2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — UBE2G2
Entrez GeneID
7327GeneBank Accession#
NM_182688.1Protein Accession#
NP_872630.1Gene Name
UBE2G2
Gene Alias
UBC7
Gene Description
ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast)
Omim ID
603124Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
ubiquitin carrier protein G2|ubiquitin conjugating enzyme 7|ubiquitin conjugating enzyme G2|ubiquitin-conjugating enzyme E2G 2|ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7)|ubiquitin-protein ligase G2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com