Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE2G2 polyclonal antibody (A01)

  • Catalog # : H00007327-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant UBE2G2.
  • Immunogen:
  • UBE2G2 (NP_003329, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007327-A01
    Western Blot detection against Immunogen (35.68 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7327
  • Gene Name:
  • UBE2G2
  • Gene Alias:
  • UBC7
  • Gene Description:
  • ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast)
  • Gene Summary:
  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • ubiquitin carrier protein G2,ubiquitin conjugating enzyme 7,ubiquitin conjugating enzyme G2,ubiquitin-conjugating enzyme E2G 2,ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7),ubiquitin-protein ligase G2
  • RSS
  • YouTube
  • Linkedin
  • Facebook