UBE2G1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human UBE2G1 full-length ORF ( AAH02775, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
44.44
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — UBE2G1
Entrez GeneID
7326GeneBank Accession#
BC002775Protein Accession#
AAH02775Gene Name
UBE2G1
Gene Alias
E217K, UBC7, UBE2G
Gene Description
ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast)
Omim ID
601569Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family and catalyzes the covalent attachment of ubiquitin to other proteins. The protein may be involved in degradation of muscle-specific proteins. [provided by RefSeq
Other Designations
ubiquitin carrier protein G1|ubiquitin-conjugating enzyme E2G 1|ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans)|ubiquitin-conjugating enzyme E2G 1 (homologous to C. elegans UBC7)|ubiquitin-protein ligase G1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com