UBE2G1 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of UBE2G1 expression in transfected 293T cell line (H00007326-T01) by UBE2G1 MaxPab polyclonal antibody.
Lane 1: UBE2G1 transfected lysate(18.7 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human UBE2G1 protein.
Immunogen
UBE2G1 (NP_003333.1, 1 a.a. ~ 170 a.a) full-length human protein.
Sequence
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UBE2G1 expression in transfected 293T cell line (H00007326-T01) by UBE2G1 MaxPab polyclonal antibody.
Lane 1: UBE2G1 transfected lysate(18.7 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — UBE2G1
Entrez GeneID
7326GeneBank Accession#
NM_003342.4Protein Accession#
NP_003333.1Gene Name
UBE2G1
Gene Alias
E217K, UBC7, UBE2G
Gene Description
ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast)
Omim ID
601569Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family and catalyzes the covalent attachment of ubiquitin to other proteins. The protein may be involved in degradation of muscle-specific proteins. [provided by RefSeq
Other Designations
ubiquitin carrier protein G1|ubiquitin-conjugating enzyme E2G 1|ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans)|ubiquitin-conjugating enzyme E2G 1 (homologous to C. elegans UBC7)|ubiquitin-protein ligase G1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com