Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE2G1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00007326-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human UBE2G1 protein.
  • Immunogen:
  • UBE2G1 (NP_003333.1, 1 a.a. ~ 170 a.a) full-length human protein.
  • Sequence:
  • MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of UBE2G1 expression in transfected 293T cell line (H00007326-T01) by UBE2G1 MaxPab polyclonal antibody.

    Lane 1: UBE2G1 transfected lysate(18.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7326
  • Gene Name:
  • UBE2G1
  • Gene Alias:
  • E217K,UBC7,UBE2G
  • Gene Description:
  • ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast)
  • Gene Summary:
  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family and catalyzes the covalent attachment of ubiquitin to other proteins. The protein may be involved in degradation of muscle-specific proteins. [provided by RefSeq
  • Other Designations:
  • ubiquitin carrier protein G1,ubiquitin-conjugating enzyme E2G 1,ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans),ubiquitin-conjugating enzyme E2G 1 (homologous to C. elegans UBC7),ubiquitin-protein ligase G1
  • RSS
  • YouTube
  • Linkedin
  • Facebook