UBE2D1 monoclonal antibody (M01), clone 2C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UBE2D1.
Immunogen
UBE2D1 (NP_003329, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UBE2D1 expression in transfected 293T cell line by UBE2D1 monoclonal antibody (M01), clone 2C6.
Lane 1: UBE2D1 transfected lysate(16.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to UBE2D1 on formalin-fixed paraffin-embedded human cervix cancer. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE2D1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — UBE2D1
Entrez GeneID
7321GeneBank Accession#
NM_003338Protein Accession#
NP_003329Gene Name
UBE2D1
Gene Alias
E2(17)KB1, SFT, UBC4/5, UBCH5, UBCH5A
Gene Description
ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)
Omim ID
602961Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. [provided by RefSeq
Other Designations
OTTHUMP00000019631|stimulator of Fe transport|ubiquitin carrier protein|ubiquitin-conjugating enzyme E2-17 kDa 1|ubiquitin-conjugating enzyme E2D 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The stability of HSV-1 ICP0 early after infection is defined by the RING finger and the UL13 protein kinase.
Zhu Z, Du T, Zhou G, Roizman B.
Journal of Virology 2014 May; 88(10):5437.
Application:WB-Tr, Human, HEp-2 cells.
-
The stability of HSV-1 ICP0 early after infection is defined by the RING finger and the UL13 protein kinase.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com