Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007317-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UBE1 partial ORF ( NP_003325, 751 a.a. - 850 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007317-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7317
  • Gene Name:
  • UBA1
  • Gene Alias:
  • A1S9,A1S9T,A1ST,AMCX1,GXP1,MGC4781,SMAX2,UBA1A,UBE1,UBE1X
  • Gene Description:
  • ubiquitin-like modifier activating enzyme 1
  • Gene Summary:
  • The protein encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described. [provided by RefSeq
  • Other Designations:
  • A1S9T and BN75 temperature sensitivity complementing,OTTHUMP00000023197,OTTHUMP00000023198,UBA1, ubiquitin-activating enzyme E1 homolog A,ubiquitin-activating enzyme E1
  • RSS
  • YouTube
  • Linkedin
  • Facebook