Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBA52 polyclonal antibody (A01)

  • Catalog # : H00007311-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant UBA52.
  • Immunogen:
  • UBA52 (NP_003324, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007311-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7311
  • Gene Name:
  • UBA52
  • Gene Alias:
  • CEP52,HUBCEP52,MGC126879,MGC126881,MGC57125,RPL40
  • Gene Description:
  • ubiquitin A-52 residue ribosomal protein fusion product 1
  • Gene Summary:
  • Ubiquitin is a highly conserved nuclear and cytoplasmic protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein L40 at the C terminus, a C-terminal extension protein (CEP). Multiple processed pseudogenes derived from this gene are present in the genome. [provided by RefSeq
  • Other Designations:
  • 60S ribosomal protein L40,ribosomal protein L40,ubiquitin and ribosomal protein L40,ubiquitin carboxyl extension protein 52,ubiquitin-52 amino acid fusion protein,ubiquitin-CEP52
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook