U2AF1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human U2AF1 partial ORF ( NP_006749.1, 56 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
QNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — U2AF1
Entrez GeneID
7307GeneBank Accession#
NM_006758Protein Accession#
NP_006749.1Gene Name
U2AF1
Gene Alias
DKFZp313J1712, FP793, RN, RNU2AF1, U2AF35, U2AFBP
Gene Description
U2 small nuclear RNA auxiliary factor 1
Omim ID
191317Gene Ontology
HyperlinkGene Summary
This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which plays a critical role in both constitutive and enhancer-dependent RNA splicing by directly mediating interactions between the large subunit and proteins bound to the enhancers. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
U2 small nuclear RNA auxillary factor 1|U2 small nuclear ribonucleoprotein auxillary factor, 35-KD subunit|U2 snRNP auxiliary factor small subunit|U2(RNU2) small nuclear RNA auxiliary factor 1|U2(RNU2) small nuclear RNA auxiliary factor binding protein|sp
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com