Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

U2AF1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007307-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human U2AF1 partial ORF ( NP_006749.1, 56 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007307-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7307
  • Gene Name:
  • U2AF1
  • Gene Alias:
  • DKFZp313J1712,FP793,RN,RNU2AF1,U2AF35,U2AFBP
  • Gene Description:
  • U2 small nuclear RNA auxiliary factor 1
  • Gene Summary:
  • This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which plays a critical role in both constitutive and enhancer-dependent RNA splicing by directly mediating interactions between the large subunit and proteins bound to the enhancers. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • U2 small nuclear RNA auxillary factor 1,U2 small nuclear ribonucleoprotein auxillary factor, 35-KD subunit,U2 snRNP auxiliary factor small subunit,U2(RNU2) small nuclear RNA auxiliary factor 1,U2(RNU2) small nuclear RNA auxiliary factor binding protein,sp
  • RSS
  • YouTube
  • Linkedin
  • Facebook