TYRO3 monoclonal antibody (M05), clone 4F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TYRO3.
Immunogen
TYRO3 (AAH49368, 50 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TYRO3 expression in transfected 293T cell line by TYRO3 monoclonal antibody (M05), clone 4F6.
Lane 1: TYRO3 transfected lysate(96.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TYRO3 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TYRO3 over-expressed 293 cell line, cotransfected with TYRO3 Validated Chimera RNAi ( Cat # H00007301-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TYRO3 monoclonal antibody (M05) clone 4F6 (Cat # H00007301-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TYRO3
Entrez GeneID
7301GeneBank Accession#
BC049368Protein Accession#
AAH49368Gene Name
TYRO3
Gene Alias
BYK, Brt, Dtk, FLJ16467, RSE, Sky, Tif
Gene Description
TYRO3 protein tyrosine kinase
Omim ID
600341Gene Ontology
HyperlinkOther Designations
Tyro3 protein tyrosine kinase (sea-related receptor tyrosine kinase)|tyrosine-protein kinase receptor TYRO3
-
Interactome
-
Disease
-
Publication Reference
-
Targeting BRD3 eradicates nuclear TYRO3-induced colorectal cancer metastasis.
Pei-Ling Hsu, Chun-Wei Chien, Yen-An Tang, Bo-Wen Lin, Shih-Chieh Lin, Yi-Syuan Lin, Sih-Yu Chen, H Sunny Sun, Shaw-Jenq Tsai.
Science Advances 2023 Apr; 9(15):eade3422.
Application:IF, IHC-P, Human, Human colorectal cancer, Human colon, HCT116 cells.
-
Targeting BRD3 eradicates nuclear TYRO3-induced colorectal cancer metastasis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com